SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mkra1 (5mkr A:1-188)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2122051Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2122052Family c.55.1.1: Actin/HSP70 [53068] (8 protein domains)
  6. 2122439Protein automated matches [226905] (12 species)
    not a true protein
  7. 2122491Species Human (Homo sapiens) [TaxId:9606] [225574] (46 PDB entries)
  8. 2287153Domain d5mkra1: 5mkr A:1-188 [330454]
    Other proteins in same PDB: d5mkra3
    automated match to d1hjoa1
    complexed with flc, ti8

Details for d5mkra1

PDB Entry: 5mkr (more details), 1.87 Å

PDB Description: hsp72-nbd bound to compound tci 8 - tyr15 in up-conformation
PDB Compounds: (A:) heat shock 70 kda protein 1a

SCOPe Domain Sequences for d5mkra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mkra1 c.55.1.1 (A:1-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
makaaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqva
lnpqntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeis
smvltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaa
iaygldrt

SCOPe Domain Coordinates for d5mkra1:

Click to download the PDB-style file with coordinates for d5mkra1.
(The format of our PDB-style files is described here.)

Timeline for d5mkra1:

  • d5mkra1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02