Lineage for d5tx4b_ (5tx4 B:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2232568Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2232569Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2232656Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 protein domains)
  6. 2232729Protein TGF-beta2 [57510] (2 species)
  7. 2232730Species Human (Homo sapiens) [TaxId:9606] [57511] (4 PDB entries)
  8. 2287152Domain d5tx4b_: 5tx4 B: [330453]
    Other proteins in same PDB: d5tx4a_
    automated match to d2tgia_

Details for d5tx4b_

PDB Entry: 5tx4 (more details), 1.88 Å

PDB Description: derivative of mouse tgf-beta2, with a deletion of residues 52-71 and k25r, r26k, l51r, a74k, c77s, l89v, i92v, k94r t95k, i98v single amino acid substitutions, bound to human tgf-beta type ii receptor ectodomain residues 15-130
PDB Compounds: (B:) Transforming growth factor beta-2

SCOPe Domain Sequences for d5tx4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tx4b_ g.17.1.2 (B:) TGF-beta2 {Human (Homo sapiens) [TaxId: 9606]}
aldaaycfrnvqdncclrplyidfrkdlgwkwihepkgynanfcagacpyraskspscvs
qdlepltivyyvgrkpkveqlsnmivksckcs

SCOPe Domain Coordinates for d5tx4b_:

Click to download the PDB-style file with coordinates for d5tx4b_.
(The format of our PDB-style files is described here.)

Timeline for d5tx4b_:

  • d5tx4b_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02

View in 3D
Domains from other chains:
(mouse over for more information)
d5tx4a_