SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tx4b_ (5tx4 B:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2232568Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2232569Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2232656Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 protein domains)
  6. 2232729Protein TGF-beta2 [57510] (2 species)
  7. 2232730Species Human (Homo sapiens) [TaxId:9606] [57511] (4 PDB entries)
  8. 2287152Domain d5tx4b_: 5tx4 B: [330453]
    Other proteins in same PDB: d5tx4a_
    automated match to d2tgia_

Details for d5tx4b_

PDB Entry: 5tx4 (more details), 1.88 Å

PDB Description: derivative of mouse tgf-beta2, with a deletion of residues 52-71 and k25r, r26k, l51r, a74k, c77s, l89v, i92v, k94r t95k, i98v single amino acid substitutions, bound to human tgf-beta type ii receptor ectodomain residues 15-130
PDB Compounds: (B:) Transforming growth factor beta-2

SCOPe Domain Sequences for d5tx4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tx4b_ g.17.1.2 (B:) TGF-beta2 {Human (Homo sapiens) [TaxId: 9606]}
aldaaycfrnvqdncclrplyidfrkdlgwkwihepkgynanfcagacpyraskspscvs
qdlepltivyyvgrkpkveqlsnmivksckcs

SCOPe Domain Coordinates for d5tx4b_:

Click to download the PDB-style file with coordinates for d5tx4b_.
(The format of our PDB-style files is described here.)

Timeline for d5tx4b_:

  • d5tx4b_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02

View in 3D
Domains from other chains:
(mouse over for more information)
d5tx4a_