SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tx6b_ (5tx6 B:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2232568Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2232569Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2232656Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 protein domains)
  6. 2232729Protein TGF-beta2 [57510] (2 species)
  7. 2287150Species Mus musculus [TaxId:10090] [330451] (2 PDB entries)
  8. 2287151Domain d5tx6b_: 5tx6 B: [330452]
    automated match to d2tgia_
    complexed with ca; mutant

Details for d5tx6b_

PDB Entry: 5tx6 (more details), 2.75 Å

PDB Description: structure of tgf-beta2 derivative with deletion of residues 52-71 and 10 single amino acid mutations (mmtgf-beta2-7m)
PDB Compounds: (B:) Transforming growth factor beta-2

SCOPe Domain Sequences for d5tx6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tx6b_ g.17.1.2 (B:) TGF-beta2 {Mus musculus [TaxId: 10090]}
aldaaycfrnvqdncclrplyidfrkdlgwkwihepkgynanfcagacpyraskspscvs
qdlepltivyyvgrkpkveqlsnmivksckcs

SCOPe Domain Coordinates for d5tx6b_:

Click to download the PDB-style file with coordinates for d5tx6b_.
(The format of our PDB-style files is described here.)

Timeline for d5tx6b_:

  • d5tx6b_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02