SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ifka_ (5ifk A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2126300Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 2126301Protein automated matches [190781] (41 species)
    not a true protein
  7. 2287102Species Kluyveromyces lactis [TaxId:284590] [330403] (1 PDB entry)
  8. 2287149Domain d5ifka_: 5ifk A: [330450]
    automated match to d3khsa_
    complexed with hpa

Details for d5ifka_

PDB Entry: 5ifk (more details), 1.97 Å

PDB Description: purine nucleoside phosphorylase
PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d5ifka_:

Sequence, based on SEQRES records: (download)

>d5ifka_ c.56.2.0 (A:) automated matches {Kluyveromyces lactis [TaxId: 284590]}
dineqraliksahryisekledhfsseflpkalvicgsglsgistkiadepkplilsyst
ipgfkvstvpghsgelifgymngapvvlmngrlhsyeghslaetvhpiralhllgsinvl
ivtnaagginasfkagdlmcvydhinfpglcgfhplrganfdefgprflatsdaydlelr
kllfskkkelnierkihegtysyvhgptfesraesrflrlagtdavgmstvpevvtarhc
gwrvlalslitnecvvdppasahdenpvpiqegkatheevlensakaskdvqelifsvva
ei

Sequence, based on observed residues (ATOM records): (download)

>d5ifka_ c.56.2.0 (A:) automated matches {Kluyveromyces lactis [TaxId: 284590]}
dineqraliksahryisekledhfsseflpkalvicgsglsgistkiadepkplilsyst
ipgfkvgelifgymngapvvlmngrlhsyeghslaetvhpiralhllgsinvlivtnaag
ginasfkagdlmcvydhinfpglcgfhplrganfdefgprflatsdaydlelrkllfskk
kelnierkihegtysyvhgptfesraesrflrlagtdavgmstvpevvtarhcgwrvlal
slitnecvvdppasahdenpvpiqegkatheevlensakaskdvqelifsvvaei

SCOPe Domain Coordinates for d5ifka_:

Click to download the PDB-style file with coordinates for d5ifka_.
(The format of our PDB-style files is described here.)

Timeline for d5ifka_:

  • d5ifka_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02