Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (15 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins) |
Protein Yeast prion protein ure2p, nitrogen regulation fragment [52886] (1 species) similar to class phi enzymes |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52887] (8 PDB entries) |
Domain d1g6wa2: 1g6w A:100-200 [33045] Other proteins in same PDB: d1g6wa1, d1g6wb1, d1g6wc1, d1g6wd1 |
PDB Entry: 1g6w (more details), 2.5 Å
SCOP Domain Sequences for d1g6wa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6wa2 c.47.1.5 (A:100-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae)} sritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrapefvsv npnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpl
Timeline for d1g6wa2: