SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n6sb_ (5n6s B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2082923Protein Beta-glucosidase A [51528] (9 species)
  7. 2082968Species Thermotoga maritima [TaxId:2336] [89475] (8 PDB entries)
    Uniprot Q08638
  8. 2287142Domain d5n6sb_: 5n6s B: [330443]
    automated match to d1oifa_
    complexed with 8p5, act, cl, edo, imd, peg, pge

Details for d5n6sb_

PDB Entry: 5n6s (more details), 2.1 Å

PDB Description: thermotoga maritima family 1 glycoside hydrolase complexed with carba- cyclophellitol transition state mimic
PDB Compounds: (B:) beta-glucosidase a

SCOPe Domain Sequences for d5n6sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n6sb_ c.1.8.4 (B:) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]}
vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm
hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse
dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys
tqkrivkdsgywysnvvknngle

SCOPe Domain Coordinates for d5n6sb_:

Click to download the PDB-style file with coordinates for d5n6sb_.
(The format of our PDB-style files is described here.)

Timeline for d5n6sb_:

  • d5n6sb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02