SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5sxpb_ (5sxp B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2045783Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2045784Family b.34.2.1: SH3-domain [50045] (40 protein domains)
  6. 2046151Protein automated matches [190043] (6 species)
    not a true protein
  7. 2046216Species Norway rat (Rattus norvegicus) [TaxId:10116] [187407] (8 PDB entries)
  8. 2287137Domain d5sxpb_: 5sxp B: [330438]
    automated match to d2ak5a_

Details for d5sxpb_

PDB Entry: 5sxp (more details), 1.65 Å

PDB Description: structural basis for the interaction between itch prr and beta-pix
PDB Compounds: (B:) Rho guanine nucleotide exchange factor 7

SCOPe Domain Sequences for d5sxpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sxpb_ b.34.2.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
snnqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegtlngrtgwfpsnyvrevk
a

SCOPe Domain Coordinates for d5sxpb_:

Click to download the PDB-style file with coordinates for d5sxpb_.
(The format of our PDB-style files is described here.)

Timeline for d5sxpb_:

  • d5sxpb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02