Lineage for d5sxpb_ (5sxp B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377019Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2377020Family b.34.2.1: SH3-domain [50045] (40 protein domains)
  6. 2377400Protein automated matches [190043] (6 species)
    not a true protein
  7. 2377424Species Human (Homo sapiens) [TaxId:9606] [187799] (30 PDB entries)
  8. 2377446Domain d5sxpb_: 5sxp B: [330438]
    automated match to d2ak5a_

Details for d5sxpb_

PDB Entry: 5sxp (more details), 1.65 Å

PDB Description: structural basis for the interaction between itch prr and beta-pix
PDB Compounds: (B:) Rho guanine nucleotide exchange factor 7

SCOPe Domain Sequences for d5sxpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sxpb_ b.34.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snnqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegtlngrtgwfpsnyvrevk
a

SCOPe Domain Coordinates for d5sxpb_:

Click to download the PDB-style file with coordinates for d5sxpb_.
(The format of our PDB-style files is described here.)

Timeline for d5sxpb_: