SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m34a_ (5m34 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143341Family c.92.2.2: TroA-like [53811] (6 protein domains)
  6. 2143368Protein automated matches [191053] (5 species)
    not a true protein
  7. 2286203Species Escherichia coli [TaxId:83333] [329504] (3 PDB entries)
  8. 2287129Domain d5m34a_: 5m34 A: [330430]
    Other proteins in same PDB: d5m34b2
    automated match to d1n2za_
    complexed with cby, cyn, gol; mutant

Details for d5m34a_

PDB Entry: 5m34 (more details), 1.6 Å

PDB Description: structure of cobinamide-bound btuf mutant w66y, the periplasmic vitamin b12 binding protein in e.coli
PDB Compounds: (A:) Vitamin B12-binding protein

SCOPe Domain Sequences for d5m34a_:

Sequence, based on SEQRES records: (download)

>d5m34a_ c.92.2.2 (A:) automated matches {Escherichia coli [TaxId: 83333]}
aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstyqgmnlerivalkpdl
viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
eqvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcna
lsqvd

Sequence, based on observed residues (ATOM records): (download)

>d5m34a_ c.92.2.2 (A:) automated matches {Escherichia coli [TaxId: 83333]}
aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstyqgmnlerivalkpdl
viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
eqvlarspqaivitkipvipltsdwferaspriilaaqqlcnalsqvd

SCOPe Domain Coordinates for d5m34a_:

Click to download the PDB-style file with coordinates for d5m34a_.
(The format of our PDB-style files is described here.)

Timeline for d5m34a_:

  • d5m34a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02