Lineage for d2nbja_ (2nbj A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214627Fold d.247: Chromosomal protein MC1 [102874] (1 superfamily)
    beta(2)-alpha-beta(3); 2 layers: alpha/beta
  4. 2214628Superfamily d.247.1: Chromosomal protein MC1 [102875] (1 family) (S)
    automatically mapped to Pfam PF05854
  5. 2214629Family d.247.1.1: Chromosomal protein MC1 [102876] (1 protein)
  6. 2214630Protein Chromosomal protein MC1 [102877] (2 species)
  7. 2287126Species Methanosarcina thermophila [TaxId:1434121] [330427] (1 PDB entry)
  8. 2287127Domain d2nbja_: 2nbj A: [330428]
    automated match to d2khla_
    protein/DNA complex

Details for d2nbja_

PDB Entry: 2nbj (more details)

PDB Description: dna-archeal mc1 protein complex structure by nmr
PDB Compounds: (A:) Chromosomal protein MC1

SCOPe Domain Sequences for d2nbja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nbja_ d.247.1.1 (A:) Chromosomal protein MC1 {Methanosarcina thermophila [TaxId: 1434121]}
sntrnfvlrdedgnehgvftgkqprqaalkaanrgsgtkanpdiirlrergtkkvhvfka
wkeivdapknrpawmpekiskpfvkkeriekle

SCOPe Domain Coordinates for d2nbja_:

Click to download the PDB-style file with coordinates for d2nbja_.
(The format of our PDB-style files is described here.)

Timeline for d2nbja_:

  • d2nbja_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-01