SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2nbja_ (2nbj A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214627Fold d.247: Chromosomal protein MC1 [102874] (1 superfamily)
    beta(2)-alpha-beta(3); 2 layers: alpha/beta
  4. 2214628Superfamily d.247.1: Chromosomal protein MC1 [102875] (1 family) (S)
    automatically mapped to Pfam PF05854
  5. 2214629Family d.247.1.1: Chromosomal protein MC1 [102876] (1 protein)
  6. 2214630Protein Chromosomal protein MC1 [102877] (2 species)
  7. 2287126Species Methanosarcina thermophila [TaxId:1434121] [330427] (1 PDB entry)
  8. 2287127Domain d2nbja_: 2nbj A: [330428]
    automated match to d2khla_
    protein/DNA complex

Details for d2nbja_

PDB Entry: 2nbj (more details)

PDB Description: dna-archeal mc1 protein complex structure by nmr
PDB Compounds: (A:) Chromosomal protein MC1

SCOPe Domain Sequences for d2nbja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nbja_ d.247.1.1 (A:) Chromosomal protein MC1 {Methanosarcina thermophila [TaxId: 1434121]}
sntrnfvlrdedgnehgvftgkqprqaalkaanrgsgtkanpdiirlrergtkkvhvfka
wkeivdapknrpawmpekiskpfvkkeriekle

SCOPe Domain Coordinates for d2nbja_:

Click to download the PDB-style file with coordinates for d2nbja_.
(The format of our PDB-style files is described here.)

Timeline for d2nbja_:

  • d2nbja_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-01