SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jbsd_ (5jbs D:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161468Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2161993Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2162681Family d.17.4.26: VirB8-like [160029] (2 protein domains)
    Pfam PF04335
  6. 2162701Protein automated matches [190553] (2 species)
    not a true protein
  7. 2287043Species Brucella suis [TaxId:204722] [330344] (1 PDB entry)
  8. 2287124Domain d5jbsd_: 5jbs D: [330425]
    automated match to d2bhma1
    complexed with cl, epe, gol, peg

Details for d5jbsd_

PDB Entry: 5jbs (more details), 1.95 Å

PDB Description: conformational changes during monomer-to-dimer transition of brucella suis virb8
PDB Compounds: (D:) type IV secretion system protein virb8

SCOPe Domain Sequences for d5jbsd_:

Sequence, based on SEQRES records: (download)

>d5jbsd_ d.17.4.26 (D:) automated matches {Brucella suis [TaxId: 204722]}
sydtvrdkywlsqyviaretydwytlqkdyetvgmlsspsegqsyasqfqgdkaldkqyg
snvrtsvtivsivpngkgigtvrfakttkrtnetgdgetthwiatigyqyvnpslmsesa
rltnplgfnvtsyrvdpemg

Sequence, based on observed residues (ATOM records): (download)

>d5jbsd_ d.17.4.26 (D:) automated matches {Brucella suis [TaxId: 204722]}
sydtvrdkywlsqyviaretydwytlqkdyetvgmlsspsegqsyasqfqldkqygsnvr
tsvtivsivpngkgigtvrfakttkrtnetgdgetthwiatigyqyvnpslmsesarltn
plgfnvtsyrvdpemg

SCOPe Domain Coordinates for d5jbsd_:

Click to download the PDB-style file with coordinates for d5jbsd_.
(The format of our PDB-style files is described here.)

Timeline for d5jbsd_:

  • d5jbsd_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02