Lineage for d5jbsb_ (5jbs B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2504826Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2505360Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2506124Family d.17.4.26: VirB8-like [160029] (2 protein domains)
    Pfam PF04335
  6. 2506144Protein automated matches [190553] (2 species)
    not a true protein
  7. 2506147Species Brucella suis [TaxId:204722] [330344] (1 PDB entry)
  8. 2506149Domain d5jbsb_: 5jbs B: [330424]
    automated match to d2bhma1
    complexed with cl, epe, gol, peg

Details for d5jbsb_

PDB Entry: 5jbs (more details), 1.95 Å

PDB Description: conformational changes during monomer-to-dimer transition of brucella suis virb8
PDB Compounds: (B:) type IV secretion system protein virb8

SCOPe Domain Sequences for d5jbsb_:

Sequence, based on SEQRES records: (download)

>d5jbsb_ d.17.4.26 (B:) automated matches {Brucella suis [TaxId: 204722]}
sydtvrdkywlsqyviaretydwytlqkdyetvgmlsspsegqsyasqfqgdkaldkqyg
snvrtsvtivsivpngkgigtvrfakttkrtnetgdgetthwiatigyqyvnpslmsesa
rltnplgfnvtsyrvdpe

Sequence, based on observed residues (ATOM records): (download)

>d5jbsb_ d.17.4.26 (B:) automated matches {Brucella suis [TaxId: 204722]}
sydtvrdkywlsqyviaretydwytlqkdyetvgmlsspsegqsyasqfnvrtsvtivsi
vpngkgigtvrfakttkrtnetgdgetthwiatigyqyvnpslmsesarltnplgfnvts
yrvdpe

SCOPe Domain Coordinates for d5jbsb_:

Click to download the PDB-style file with coordinates for d5jbsb_.
(The format of our PDB-style files is described here.)

Timeline for d5jbsb_: