SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ka0a_ (5ka0 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116650Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2116651Protein automated matches [190475] (8 species)
    not a true protein
  7. 2116663Species Human (Homo sapiens) [TaxId:9606] [187400] (110 PDB entries)
  8. 2287120Domain d5ka0a_: 5ka0 A: [330421]
    automated match to d2i1yb_
    complexed with cl, gol, trs

Details for d5ka0a_

PDB Entry: 5ka0 (more details), 1.99 Å

PDB Description: protein tyrosine phosphatase 1b delta helix 7, open state
PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d5ka0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ka0a_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfi

SCOPe Domain Coordinates for d5ka0a_:

Click to download the PDB-style file with coordinates for d5ka0a_.
(The format of our PDB-style files is described here.)

Timeline for d5ka0a_:

  • d5ka0a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-01