Lineage for d1f2ed2 (1f2e D:1-80)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 123181Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 123182Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 123318Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 123330Protein Glutathione S-transferase [52863] (24 species)
  7. 123583Species Sphingomonas paucimobilis [TaxId:13689] [52885] (1 PDB entry)
  8. 123587Domain d1f2ed2: 1f2e D:1-80 [33042]
    Other proteins in same PDB: d1f2ea1, d1f2eb1, d1f2ec1, d1f2ed1

Details for d1f2ed2

PDB Entry: 1f2e (more details), 2.3 Å

PDB Description: structure of sphingomonad, glutathione s-transferase complexed with glutathione

SCOP Domain Sequences for d1f2ed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2ed2 c.47.1.5 (D:1-80) Glutathione S-transferase {Sphingomonas paucimobilis}
mklfispgacslaphialretgadfeavkvdlavrkteagedfltvnpsgkvpaltldsg
etltenpaillyiadqnpas

SCOP Domain Coordinates for d1f2ed2:

Click to download the PDB-style file with coordinates for d1f2ed2.
(The format of our PDB-style files is described here.)

Timeline for d1f2ed2: