Lineage for d5m2qa_ (5m2q A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143341Family c.92.2.2: TroA-like [53811] (6 protein domains)
  6. 2143368Protein automated matches [191053] (5 species)
    not a true protein
  7. 2287110Species Escherichia coli [TaxId:562] [330411] (1 PDB entry)
  8. 2287111Domain d5m2qa_: 5m2q A: [330412]
    Other proteins in same PDB: d5m2qb2
    automated match to d1n2za_
    complexed with cby, cyn, gol; mutant

Details for d5m2qa_

PDB Entry: 5m2q (more details), 1.7 Å

PDB Description: structure of cobinamide-bound btuf mutant w66f, the periplasmic vitamin b12 binding protein in e.coli
PDB Compounds: (A:) Outer membrane protein A,Vitamin B12-binding protein

SCOPe Domain Sequences for d5m2qa_:

Sequence, based on SEQRES records: (download)

>d5m2qa_ c.92.2.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
aprvitlspantelafaagitpvgvssysdyppqaqkieqvstfqgmnlerivalkpdlv
iawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslldq
yaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsre
qvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcnal
sqvd

Sequence, based on observed residues (ATOM records): (download)

>d5m2qa_ c.92.2.2 (A:) automated matches {Escherichia coli [TaxId: 562]}
aprvitlspantelafaagitpvgvssysdyppqaqkieqvstfqgmnlerivalkpdlv
iawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslldq
yaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsre
qvlarspqaivitgkipvipltsdwferaspriilaaqqlcnalsqvd

SCOPe Domain Coordinates for d5m2qa_:

Click to download the PDB-style file with coordinates for d5m2qa_.
(The format of our PDB-style files is described here.)

Timeline for d5m2qa_:

  • d5m2qa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-01