SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lt0a_ (5lt0 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111709Protein automated matches [190129] (6 species)
    not a true protein
  7. 2111718Species Human (Homo sapiens) [TaxId:9606] [187145] (33 PDB entries)
  8. 2287095Domain d5lt0a_: 5lt0 A: [330396]
    automated match to d1bg2a_
    complexed with act, so4, sr

Details for d5lt0a_

PDB Entry: 5lt0 (more details), 2 Å

PDB Description: nucleotide-free kinesin-1 motor domain, p212121 crystal form
PDB Compounds: (A:) Kinesin-like protein

SCOPe Domain Sequences for d5lt0a_:

Sequence, based on SEQRES records: (download)

>d5lt0a_ c.37.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snikvmcrfrplnesevnrgdkyiakfqgedtvviaskpyafdrvfqsstsqeqvyndaa
kkivkdvlegyngtifaygqtssgkthtmegklhdpegmgiiprivqdifnyiysmdenl
efhikvsyfeiyldkirdlldvsktnlsvhedknrvpyvkgaterfvsspdevmdtideg
ksnrhvavtnmnehssrshsiflinvkqentqteqklsgklylvdlagsekvsktgaega
vldeakninkslsalgnvisalaegstyvpyrdskmtrilqdslggnarttiviccspss
ynesetkstllfgqrakti

Sequence, based on observed residues (ATOM records): (download)

>d5lt0a_ c.37.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snikvmcrfrplnesevnrgdkyiakfqgedtvviaskpyafdrvfqsstsqeqvyndaa
kkivkdvlegyngtifaygqtssgkthtmegklhdpegmgiiprivqdifnyiysmenle
fhikvsyfeiyldkirdlldvsktnlsvhedknrvpyvkgaterfvsspdevmdtidegk
snrhvavtnmnehssrshsiflinvkqentqteqklsgklylvdlagsekninkslsalg
nvisalaegstyvpyrdskmtrilqdslggnarttiviccspssynesetkstllfgqra
kti

SCOPe Domain Coordinates for d5lt0a_:

Click to download the PDB-style file with coordinates for d5lt0a_.
(The format of our PDB-style files is described here.)

Timeline for d5lt0a_:

  • d5lt0a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-01