SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ka1a1 (5ka1 A:1-282)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116650Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2116651Protein automated matches [190475] (8 species)
    not a true protein
  7. 2116663Species Human (Homo sapiens) [TaxId:9606] [187400] (110 PDB entries)
  8. 2287091Domain d5ka1a1: 5ka1 A:1-282 [330392]
    Other proteins in same PDB: d5ka1a2
    automated match to d2i1yb_
    complexed with cl, dms, gol, ota, trs; mutant

Details for d5ka1a1

PDB Entry: 5ka1 (more details), 1.84 Å

PDB Description: protein tyrosine phosphatase 1b delta helix 7 mutant in complex with tcs401, closed state
PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 1

SCOPe Domain Sequences for d5ka1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ka1a1 c.45.1.0 (A:1-282) automated matches {Human (Homo sapiens) [TaxId: 9606]}
memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim

SCOPe Domain Coordinates for d5ka1a1:

Click to download the PDB-style file with coordinates for d5ka1a1.
(The format of our PDB-style files is described here.)

Timeline for d5ka1a1:

  • d5ka1a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-01

View in 3D
Domains from same chain:
(mouse over for more information)
d5ka1a2