SCOP 1.59: Domain d1f2ea2: 1f2e A:1-80

Lineage for d1f2ea2 (1f2e A:1-80)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)

6. Protein Glutathione S-transferase [52863] (24 species)

7. Species Sphingomonas paucimobilis [TaxId:13689] [52885] (1 PDB entry)

8. Domain d1f2ea2: 1f2e A:1-80 [33039]
   Other proteins in same PDB: d1f2ea1, d1f2eb1, d1f2ec1, d1f2ed1

Details for d1f2ea2

PDB Entry: 1f2e, 2.3 Å

PDB Description: structure of sphingomonad, glutathione s-transferase complexed with glutathione

SCOP Domain Sequences for d1f2ea2:

Sequence; same for both SEQRES and ATOM records:

>d1f2ea2 c.47.1.5 (A:1-80) Glutathione S-transferase {Sphingomonas paucimobilis}
mklfispgacslaphialretgadfeavkvdlavrkteagedfltvnpsgkvpaltldsg
etltenpaillyiadqnpas

Timeline for d1f2ea2:

• d1f2ea2 first appeared (with stable ids) in SCOP 1.55
  
• d1f2ea2 appears in SCOP 1.57
  
• d1f2ea2 appears in SCOP 1.61
  
• d1f2ea2 appears in the current release, SCOPe 2.08