Lineage for d5m3bb1 (5m3b B:22-266)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143226Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2143333Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2143341Family c.92.2.2: TroA-like [53811] (6 protein domains)
  6. 2143368Protein automated matches [191053] (5 species)
    not a true protein
  7. 2286203Species Escherichia coli [TaxId:83333] [329504] (3 PDB entries)
  8. 2287088Domain d5m3bb1: 5m3b B:22-266 [330389]
    Other proteins in same PDB: d5m3bb2
    automated match to d1n2za_
    complexed with cby, cyn, gol; mutant

Details for d5m3bb1

PDB Entry: 5m3b (more details), 1.5 Å

PDB Description: structure of cobinamide-bound btuf mutant w66l, the periplasmic vitamin b12 binding protein in e.coli
PDB Compounds: (B:) Vitamin B12-binding protein

SCOPe Domain Sequences for d5m3bb1:

Sequence, based on SEQRES records: (download)

>d5m3bb1 c.92.2.2 (B:22-266) automated matches {Escherichia coli [TaxId: 83333]}
aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstlqgmnlerivalkpdl
viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
eqvlarspqaivitggpdqipkikqywgeqlkipvipltsdwferaspriilaaqqlcna
lsqvd

Sequence, based on observed residues (ATOM records): (download)

>d5m3bb1 c.92.2.2 (B:22-266) automated matches {Escherichia coli [TaxId: 83333]}
aaprvitlspantelafaagitpvgvssysdyppqaqkieqvstlqgmnlerivalkpdl
viawrggnaerqvdqlaslgikvmwvdatsieqianalrqlapwspqpdkaeqaaqslld
qyaqlkaqyadkpkkrvflqfginppftsgkesiqnqvlevcggenifkdsrvpwpqvsr
eqvlarspqaivitgkipvipltsdwferaspriilaaqqlcnalsqvd

SCOPe Domain Coordinates for d5m3bb1:

Click to download the PDB-style file with coordinates for d5m3bb1.
(The format of our PDB-style files is described here.)

Timeline for d5m3bb1:

  • d5m3bb1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-01

View in 3D
Domains from same chain:
(mouse over for more information)
d5m3bb2
View in 3D
Domains from other chains:
(mouse over for more information)
d5m3ba_