Lineage for d5gtta2 (5gtt A:211-419)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208074Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2208075Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2208361Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2208362Protein automated matches [191197] (9 species)
    not a true protein
  7. 2281344Species Clostridium perfringens [TaxId:1502] [324645] (5 PDB entries)
  8. 2287087Domain d5gtta2: 5gtt A:211-419 [330388]
    automated match to d1giqa2
    complexed with edo

Details for d5gtta2

PDB Entry: 5gtt (more details), 2.01 Å

PDB Description: crystal structure of c. perfringens iota-like enterotoxin cpile-a
PDB Compounds: (A:) Binary enterotoxin of Clostridium perfringens component a

SCOPe Domain Sequences for d5gtta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gtta2 d.166.1.0 (A:211-419) automated matches {Clostridium perfringens [TaxId: 1502]}
qlnfendvisasqwgeenyapwlkeltsnelrdinnylgggytainkylldgtigentsk
edleekisnissalkkrkipediityrrmgpnefgldlnspdydfnkvenvskfkekwlg
ktipvktfisttvlsnnisafakrklilrlhlpngsnaayvsvaegykneyevlidhgys
ykidniteyydesslggktnkliidatli

SCOPe Domain Coordinates for d5gtta2:

Click to download the PDB-style file with coordinates for d5gtta2.
(The format of our PDB-style files is described here.)

Timeline for d5gtta2:

  • d5gtta2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-01

View in 3D
Domains from same chain:
(mouse over for more information)
d5gtta1