SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jibc_ (5jib C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135729Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 protein domains)
    Pfam PF05448; AXE1
  6. 2135730Protein Acetyl xylan esterase TM0077 [110693] (1 species)
  7. 2135731Species Thermotoga maritima [TaxId:2336] [110694] (3 PDB entries)
    Uniprot Q9WXT2
  8. 2287085Domain d5jibc_: 5jib C: [330386]
    automated match to d1vlqa_
    complexed with oia

Details for d5jibc_

PDB Entry: 5jib (more details), 1.86 Å

PDB Description: crystal structure of the thermotoga maritima acetyl esterase (tm0077) complex with a substrate analog
PDB Compounds: (C:) Cephalosporin-C deacetylase

SCOPe Domain Sequences for d5jibc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jibc_ c.69.1.25 (C:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]}
fdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtfsg
yrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqgsg
wlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqeriv
iaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrdke
eivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypynnh
egggsfqaveqvkflkklfe

SCOPe Domain Coordinates for d5jibc_:

Click to download the PDB-style file with coordinates for d5jibc_.
(The format of our PDB-style files is described here.)

Timeline for d5jibc_:

  • d5jibc_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-01