Lineage for d5lhzb_ (5lhz B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007581Fold d.223: Polo-box domain [82614] (1 superfamily)
    beta(6)-alpha; antiparallel beta-sheet, meander
  4. 3007582Superfamily d.223.1: Polo-box domain [82615] (3 families) (S)
    Serine/threonine protein kinase-associated motif embedded in two distinct folds
  5. 3007583Family d.223.1.1: Swapped Polo-box domain [82616] (2 proteins)
    beta(5)-alpha-beta; forms swapped dimer with two 6-stranded antiparallel beta sheets; order [6]123[4][5]
  6. 3007588Protein automated matches [275910] (1 species)
    not a true protein
  7. 3007589Species Human (Homo sapiens) [TaxId:9606] [275911] (2 PDB entries)
  8. 3007591Domain d5lhzb_: 5lhz B: [330385]
    automated match to d1mbya_

Details for d5lhzb_

PDB Entry: 5lhz (more details), 2.51 Å

PDB Description: pb3 domain of human plk4 in complex with coiled-coil domain of stil
PDB Compounds: (B:) Serine/threonine-protein kinase PLK4

SCOPe Domain Sequences for d5lhzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhzb_ d.223.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpd
yikqklqclssillmf

SCOPe Domain Coordinates for d5lhzb_:

Click to download the PDB-style file with coordinates for d5lhzb_.
(The format of our PDB-style files is described here.)

Timeline for d5lhzb_: