SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lhzb_ (5lhz B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213704Fold d.223: Polo-box domain [82614] (1 superfamily)
    beta(6)-alpha; antiparallel beta-sheet, meander
  4. 2213705Superfamily d.223.1: Polo-box domain [82615] (3 families) (S)
    Serine/threonine protein kinase-associated motif embedded in two distinct folds
  5. 2213706Family d.223.1.1: Swapped Polo-box domain [82616] (2 protein domains)
    beta(5)-alpha-beta; forms swapped dimer with two 6-stranded antiparallel beta sheets; order [6]123[4][5]
  6. 2213711Protein automated matches [275910] (1 species)
    not a true protein
  7. 2213712Species Human (Homo sapiens) [TaxId:9606] [275911] (2 PDB entries)
  8. 2287084Domain d5lhzb_: 5lhz B: [330385]
    automated match to d1mbya_

Details for d5lhzb_

PDB Entry: 5lhz (more details), 2.51 Å

PDB Description: pb3 domain of human plk4 in complex with coiled-coil domain of stil
PDB Compounds: (B:) Serine/threonine-protein kinase PLK4

SCOPe Domain Sequences for d5lhzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhzb_ d.223.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
llksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpd
yikqklqclssillmf

SCOPe Domain Coordinates for d5lhzb_:

Click to download the PDB-style file with coordinates for d5lhzb_.
(The format of our PDB-style files is described here.)

Timeline for d5lhzb_:

  • d5lhzb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-01