Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.223: Polo-box domain [82614] (1 superfamily) beta(6)-alpha; antiparallel beta-sheet, meander |
Superfamily d.223.1: Polo-box domain [82615] (3 families) Serine/threonine protein kinase-associated motif embedded in two distinct folds |
Family d.223.1.1: Swapped Polo-box domain [82616] (2 proteins) beta(5)-alpha-beta; forms swapped dimer with two 6-stranded antiparallel beta sheets; order [6]123[4][5] |
Protein automated matches [275910] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [275911] (2 PDB entries) |
Domain d5lhzb_: 5lhz B: [330385] automated match to d1mbya_ |
PDB Entry: 5lhz (more details), 2.51 Å
SCOPe Domain Sequences for d5lhzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lhzb_ d.223.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} llksvfvknvgwatqltsgavwvqfndgsqlvvqagvssisytspngqttrygeneklpd yikqklqclssillmf
Timeline for d5lhzb_: