SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gp9a2 (5gp9 A:79-195)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008470Family a.121.1.0: automated matches [227226] (1 protein)
    not a true family
  6. 2008471Protein automated matches [226967] (5 species)
    not a true protein
  7. 2287029Species Bacillus halodurans [TaxId:272558] [330330] (2 PDB entries)
  8. 2287083Domain d5gp9a2: 5gp9 A:79-195 [330384]
    Other proteins in same PDB: d5gp9a1, d5gp9b1
    automated match to d1vi0a2
    complexed with gol, mg, plm

Details for d5gp9a2

PDB Entry: 5gp9 (more details), 1.76 Å

PDB Description: structural analysis of fatty acid degradation regulator fadr from bacillus halodurans
PDB Compounds: (A:) Transcriptional regulator (TetR/AcrR family)

SCOPe Domain Sequences for d5gp9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gp9a2 a.121.1.0 (A:79-195) automated matches {Bacillus halodurans [TaxId: 272558]}
dveeklkilvnmhfkqlaadhklaivtqlelrqsntelrlkinevlkgylnlldellmeg
kekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalvkpvhqlllgglrhr

SCOPe Domain Coordinates for d5gp9a2:

Click to download the PDB-style file with coordinates for d5gp9a2.
(The format of our PDB-style files is described here.)

Timeline for d5gp9a2:

  • d5gp9a2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-01

View in 3D
Domains from same chain:
(mouse over for more information)
d5gp9a1