SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lxtf2 (5lxt F:77-378)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2194861Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2194862Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2195211Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 protein domains)
    Pfam PF03133; PubMed 22020298
  6. 2195212Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (2 species)
  7. 2195213Species Chicken (Gallus gallus) [TaxId:9031] [311385] (28 PDB entries)
  8. 2287077Domain d5lxtf2: 5lxt F:77-378 [330378]
    Other proteins in same PDB: d5lxtb1, d5lxtb2, d5lxtc1, d5lxtc2, d5lxtd1, d5lxtd2, d5lxte_, d5lxtf1, d5lxtf3
    automated match to d3tiia2
    complexed with 7ak, acp, ca, gdp, gtp, mes, mg

Details for d5lxtf2

PDB Entry: 5lxt (more details), 1.9 Å

PDB Description: tubulin-discodermolide complex
PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d5lxtf2:

Sequence, based on SEQRES records: (download)

>d5lxtf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d5lxtf2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnltderevflaaynrrregregnvwiakssaga
gilisseaselldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyre
gvlrtssepynsanfqdktchltnhciqkeysknygryeegnemffeefnqylmdalntt
lensillqikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapac
aqklyaelcqgivdvaissvfplaptsifikl

SCOPe Domain Coordinates for d5lxtf2:

Click to download the PDB-style file with coordinates for d5lxtf2.
(The format of our PDB-style files is described here.)

Timeline for d5lxtf2:

  • d5lxtf2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02