Lineage for d5lxtd2 (5lxt D:246-441)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180205Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2180489Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2180490Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 protein domains)
  6. 2180597Protein automated matches [227071] (5 species)
    not a true protein
  7. 2180601Species Cow (Bos taurus) [TaxId:9913] [226565] (43 PDB entries)
  8. 2287073Domain d5lxtd2: 5lxt D:246-441 [330374]
    Other proteins in same PDB: d5lxtb1, d5lxtc1, d5lxtd1, d5lxte_, d5lxtf1, d5lxtf2, d5lxtf3
    automated match to d3rycd2
    complexed with 7ak, acp, ca, gdp, gtp, mes, mg

Details for d5lxtd2

PDB Entry: 5lxt (more details), 1.9 Å

PDB Description: tubulin-discodermolide complex
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d5lxtd2:

Sequence, based on SEQRES records: (download)

>d5lxtd2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d5lxtd2 d.79.2.1 (D:246-441) automated matches {Cow (Bos taurus) [TaxId: 9913]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsltvpeltqqmfdsknmmaacdprhg
ryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfi
gnstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqda
tad

SCOPe Domain Coordinates for d5lxtd2:

Click to download the PDB-style file with coordinates for d5lxtd2.
(The format of our PDB-style files is described here.)

Timeline for d5lxtd2:

  • d5lxtd2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-01