Lineage for d2pmtc2 (2pmt C:1-80)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24235Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)
  6. 24236Protein Glutathione S-transferase [52863] (22 species)
  7. 24429Species Proteus mirabilis [TaxId:584] [52884] (2 PDB entries)
  8. 24433Domain d2pmtc2: 2pmt C:1-80 [33037]
    Other proteins in same PDB: d2pmta1, d2pmtb1, d2pmtc1, d2pmtd1

Details for d2pmtc2

PDB Entry: 2pmt (more details), 2.7 Å

PDB Description: glutathione transferase from proteus mirabilis

SCOP Domain Sequences for d2pmtc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pmtc2 c.47.1.5 (C:1-80) Glutathione S-transferase {Proteus mirabilis}
mklyytpgscslsphivlretgldfsieridlrtkktesgkdflainpkgqvpvlqldng
diltegvaivqyladlkpdr

SCOP Domain Coordinates for d2pmtc2:

Click to download the PDB-style file with coordinates for d2pmtc2.
(The format of our PDB-style files is described here.)

Timeline for d2pmtc2: