Lineage for d5kshb1 (5ksh B:238-573)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (40 species)
    not a true protein
  7. 2219009Species Neisseria gonorrhoeae [TaxId:485] [225541] (3 PDB entries)
  8. 2287065Domain d5kshb1: 5ksh B:238-573 [330366]
    automated match to d3eqva2
    complexed with gol, so4; mutant

Details for d5kshb1

PDB Entry: 5ksh (more details), 2.4 Å

PDB Description: crystal structure of penicillin-binding protein 2 from neisseria gonorrhoeae containing an a501t mutation associated with cephalosporin resistance
PDB Compounds: (B:) Penicillin-binding protein 2

SCOPe Domain Sequences for d5kshb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kshb1 e.3.1.0 (B:238-573) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
sldqriqtlayeelnkaveyhqakagtvvvldartgeilalantpaydpnrpgradseqr
rnravtdmiepgsaikpfviakaldagktdlnerlntqpykigpspvrdthvypsldvrg
imqkssnvgtsklsarfgaeemydfyhelgigvrmhsgfpgetagllrnwrrwrpieqat
msfgyglqlsllqlaraytalthdgvllplsfekqavapqgkrifkestarevrnlmvsv
tepggtgtagavdgfdvgaktgttrklvngryvdnkhvgtfigfapaknprvivavtide
ptahgyyggvvagspfkkimggslnilgisptkplt

SCOPe Domain Coordinates for d5kshb1:

Click to download the PDB-style file with coordinates for d5kshb1.
(The format of our PDB-style files is described here.)

Timeline for d5kshb1:

  • d5kshb1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-01