SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kshb1 (5ksh B:238-573)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2218831Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2218832Protein automated matches [190857] (38 species)
    not a true protein
  7. 2219009Species Neisseria gonorrhoeae [TaxId:485] [225541] (3 PDB entries)
  8. 2287065Domain d5kshb1: 5ksh B:238-573 [330366]
    automated match to d3eqva2
    complexed with gol, so4; mutant

Details for d5kshb1

PDB Entry: 5ksh (more details), 2.4 Å

PDB Description: crystal structure of penicillin-binding protein 2 from neisseria gonorrhoeae containing an a501t mutation associated with cephalosporin resistance
PDB Compounds: (B:) Penicillin-binding protein 2

SCOPe Domain Sequences for d5kshb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kshb1 e.3.1.0 (B:238-573) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
sldqriqtlayeelnkaveyhqakagtvvvldartgeilalantpaydpnrpgradseqr
rnravtdmiepgsaikpfviakaldagktdlnerlntqpykigpspvrdthvypsldvrg
imqkssnvgtsklsarfgaeemydfyhelgigvrmhsgfpgetagllrnwrrwrpieqat
msfgyglqlsllqlaraytalthdgvllplsfekqavapqgkrifkestarevrnlmvsv
tepggtgtagavdgfdvgaktgttrklvngryvdnkhvgtfigfapaknprvivavtide
ptahgyyggvvagspfkkimggslnilgisptkplt

SCOPe Domain Coordinates for d5kshb1:

Click to download the PDB-style file with coordinates for d5kshb1.
(The format of our PDB-style files is described here.)

Timeline for d5kshb1:

  • d5kshb1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-01