SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b3id_ (5b3i D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987402Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 1987637Family a.24.3.0: automated matches [271165] (1 protein)
    not a true family
  6. 1987638Protein automated matches [271167] (2 species)
    not a true protein
  7. 2287017Species Hydrogenophilus thermoluteolus [TaxId:297] [330319] (1 PDB entry)
  8. 2287064Domain d5b3id_: 5b3i D: [330365]
    automated match to d3vrcb_
    complexed with hem

Details for d5b3id_

PDB Entry: 5b3i (more details), 1.89 Å

PDB Description: homo-dimeric structure of cytochrome c' from thermophilic hydrogenophilus thermoluteolus
PDB Compounds: (D:) cytochrome c prime

SCOPe Domain Sequences for d5b3id_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b3id_ a.24.3.0 (D:) automated matches {Hydrogenophilus thermoluteolus [TaxId: 297]}
dalkpedkvkfrqasyttmawnmgkikamvvdgtmpfsqtqvsaaanviaaiansgmgal
yspdtlgvvgfkksrlkenffqeqdevrkiatnfveqanklaevaamgdkdeikaqfgev
gkackachekfreee

SCOPe Domain Coordinates for d5b3id_:

Click to download the PDB-style file with coordinates for d5b3id_.
(The format of our PDB-style files is described here.)

Timeline for d5b3id_:

  • d5b3id_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-01