SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l86b_ (5l86 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002466Family a.93.1.1: CCP-like [48114] (5 protein domains)
  6. 2002776Protein automated matches [190089] (8 species)
    not a true protein
  7. 2002825Species Soybean (Glycine max) [TaxId:3847] [187116] (19 PDB entries)
  8. 2287063Domain d5l86b_: 5l86 B: [330364]
    automated match to d2y6ba_
    complexed with hem, so4

Details for d5l86b_

PDB Entry: 5l86 (more details), 1.9 Å

PDB Description: engineered ascorbate peroxidise
PDB Compounds: (B:) ascorbate peroxidase

SCOPe Domain Sequences for d5l86b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l86b_ a.93.1.1 (B:) automated matches {Soybean (Glycine max) [TaxId: 3847]}
ksyptvsadyqdavekakkklrgfiaekrcaplmlrlafhsagtfdkgtktggpfgtikh
paelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpkvpfhpgredk
pepppegrlpdptkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwtsn
plifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqkl
selgfad

SCOPe Domain Coordinates for d5l86b_:

Click to download the PDB-style file with coordinates for d5l86b_.
(The format of our PDB-style files is described here.)

Timeline for d5l86b_:

  • d5l86b_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-01