Lineage for d5lhxb_ (5lhx B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564215Fold d.223: Polo-box domain [82614] (1 superfamily)
    beta(6)-alpha; antiparallel beta-sheet, meander
  4. 2564216Superfamily d.223.1: Polo-box domain [82615] (3 families) (S)
    Serine/threonine protein kinase-associated motif embedded in two distinct folds
  5. 2564306Family d.223.1.0: automated matches [330351] (1 protein)
    not a true family
  6. 2564307Protein automated matches [330352] (1 species)
    not a true protein
  7. 2564308Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [330353] (1 PDB entry)
  8. 2564310Domain d5lhxb_: 5lhx B: [330355]
    automated match to d1mbya_

Details for d5lhxb_

PDB Entry: 5lhx (more details), 1.53 Å

PDB Description: pb3 domain of drosophila melanogaster plk4 (sak)
PDB Compounds: (B:) Serine/threonine-protein kinase PLK4

SCOPe Domain Sequences for d5lhxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhxb_ d.223.1.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
pikrinvpeigiatelshgvvqvqfydgsvvsvipsmqgggitytqpngtsthfgkgddl
pfpvrdrvgqipniqlklktapllg

SCOPe Domain Coordinates for d5lhxb_:

Click to download the PDB-style file with coordinates for d5lhxb_.
(The format of our PDB-style files is described here.)

Timeline for d5lhxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5lhxa_