SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lhxb_ (5lhx B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213704Fold d.223: Polo-box domain [82614] (1 superfamily)
    beta(6)-alpha; antiparallel beta-sheet, meander
  4. 2213705Superfamily d.223.1: Polo-box domain [82615] (3 families) (S)
    Serine/threonine protein kinase-associated motif embedded in two distinct folds
  5. 2287050Family d.223.1.0: automated matches [330351] (1 protein)
    not a true family
  6. 2287051Protein automated matches [330352] (1 species)
    not a true protein
  7. 2287052Species Drosophila melanogaster [TaxId:7227] [330353] (1 PDB entry)
  8. 2287054Domain d5lhxb_: 5lhx B: [330355]
    automated match to d1mbya_

Details for d5lhxb_

PDB Entry: 5lhx (more details), 1.53 Å

PDB Description: pb3 domain of drosophila melanogaster plk4 (sak)
PDB Compounds: (B:) Serine/threonine-protein kinase PLK4

SCOPe Domain Sequences for d5lhxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhxb_ d.223.1.0 (B:) automated matches {Drosophila melanogaster [TaxId: 7227]}
pikrinvpeigiatelshgvvqvqfydgsvvsvipsmqgggitytqpngtsthfgkgddl
pfpvrdrvgqipniqlklktapllg

SCOPe Domain Coordinates for d5lhxb_:

Click to download the PDB-style file with coordinates for d5lhxb_.
(The format of our PDB-style files is described here.)

Timeline for d5lhxb_:

  • d5lhxb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-01

View in 3D
Domains from other chains:
(mouse over for more information)
d5lhxa_