Lineage for d5lhxa_ (5lhx A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213704Fold d.223: Polo-box domain [82614] (1 superfamily)
    beta(6)-alpha; antiparallel beta-sheet, meander
  4. 2213705Superfamily d.223.1: Polo-box domain [82615] (3 families) (S)
    Serine/threonine protein kinase-associated motif embedded in two distinct folds
  5. 2287050Family d.223.1.0: automated matches [330351] (1 protein)
    not a true family
  6. 2287051Protein automated matches [330352] (1 species)
    not a true protein
  7. 2287052Species Drosophila melanogaster [TaxId:7227] [330353] (1 PDB entry)
  8. 2287053Domain d5lhxa_: 5lhx A: [330354]
    automated match to d1mbya_

Details for d5lhxa_

PDB Entry: 5lhx (more details), 1.53 Å

PDB Description: pb3 domain of drosophila melanogaster plk4 (sak)
PDB Compounds: (A:) Serine/threonine-protein kinase PLK4

SCOPe Domain Sequences for d5lhxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lhxa_ d.223.1.0 (A:) automated matches {Drosophila melanogaster [TaxId: 7227]}
nipikrinvpeigiatelshgvvqvqfydgsvvsvipsmqgggitytqpngtsthfgkgd
dlpfpvrdrvgqipniqlklktapllg

SCOPe Domain Coordinates for d5lhxa_:

Click to download the PDB-style file with coordinates for d5lhxa_.
(The format of our PDB-style files is described here.)

Timeline for d5lhxa_:

  • d5lhxa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-01

View in 3D
Domains from other chains:
(mouse over for more information)
d5lhxb_