SCOP 1.63: Domain d2pmta2: 2pmt A:1-80

Lineage for d2pmta2 (2pmt A:1-80)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (15 proteins)

6. Protein Class beta GST [81368] (3 species)

7. Species Proteus mirabilis [TaxId:584] [52884] (2 PDB entries)

8. Domain d2pmta2: 2pmt A:1-80 [33035]
   Other proteins in same PDB: d2pmta1, d2pmtb1, d2pmtc1, d2pmtd1

Details for d2pmta2

PDB Entry: 2pmt, 2.7 Å

PDB Description: glutathione transferase from proteus mirabilis

SCOP Domain Sequences for d2pmta2:

Sequence; same for both SEQRES and ATOM records:

>d2pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis}
mklyytpgscslsphivlretgldfsieridlrtkktesgkdflainpkgqvpvlqldng
diltegvaivqyladlkpdr

Timeline for d2pmta2:

• d2pmta2 first appeared (with stable ids) in SCOP 1.55
  
• d2pmta2 appears in SCOP 1.61
  
• d2pmta2 appears in SCOP 1.65
  
• d2pmta2 appears in the current release, SCOPe 2.08