Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins) the active site is between the two identical subunits |
Protein automated matches [190072] (22 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189131] (10 PDB entries) |
Domain d5i95a1: 5i95 A:41-452 [330347] Other proteins in same PDB: d5i95a2 automated match to d1lwda_ complexed with act, akg, ca, gol, ndp; mutant |
PDB Entry: 5i95 (more details), 1.54 Å
SCOPe Domain Sequences for d5i95a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i95a1 c.77.1.1 (A:41-452) automated matches {Human (Homo sapiens) [TaxId: 9606]} dkrikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtids alatqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiickniprl vpgwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgmg myntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfdk nkiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgk tieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmlek vcvetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgrq
Timeline for d5i95a1: