SCOPe 2.08: Domain d5i95a1: 5i95 A:41-452

Lineage for d5i95a1 (5i95 A:41-452)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189131] (10 PDB entries)

8. Domain d5i95a1: 5i95 A:41-452 [330347]
   Other proteins in same PDB: d5i95a2
   automated match to d1lwda_
   complexed with act, akg, ca, gol, ndp; mutant

Details for d5i95a1

PDB Entry: 5i95, 1.54 Å

PDB Description: crystal structure of human mitochondrial isocitrate dehydrogenase r140q mutant homodimer bound to nadph and alpha-ketoglutaric acid

PDB Compounds: (A:) Isocitrate dehydrogenase [NADP], mitochondrial

SCOPe Domain Sequences for d5i95a1:

Sequence; same for both SEQRES and ATOM records:

>d5i95a1 c.77.1.1 (A:41-452) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkrikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtids
alatqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiickniprl
vpgwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgmg
myntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfdk
nkiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgk
tieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmlek
vcvetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgrq

Timeline for d5i95a1:

• d5i95a1 first appeared in SCOPe 2.06
  
• d5i95a1 appears in SCOPe 2.07