Lineage for d5b5gc_ (5b5g C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2063610Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2063611Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2063612Family b.61.1.1: Avidin/streptavidin [50877] (3 protein domains)
  6. 2063930Protein automated matches [190191] (2 species)
    not a true protein
  7. 2064009Species Streptomyces avidinii [TaxId:1895] [189343] (45 PDB entries)
  8. 2287041Domain d5b5gc_: 5b5g C: [330342]
    automated match to d4yvbb_
    complexed with 6fx, so3

Details for d5b5gc_

PDB Entry: 5b5g (more details), 1.5 Å

PDB Description: crystal structure of alis4-streptavidin complex
PDB Compounds: (C:) streptavidin

SCOPe Domain Sequences for d5b5gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b5gc_ b.61.1.1 (C:) automated matches {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp

SCOPe Domain Coordinates for d5b5gc_:

Click to download the PDB-style file with coordinates for d5b5gc_.
(The format of our PDB-style files is described here.)

Timeline for d5b5gc_:

  • d5b5gc_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-01