Lineage for d1pmt_2 (1pmt 1-80)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (10 families) 
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins) Protein Glutathione S-transferase [52863] (22 species) 
Species Proteus mirabilis [TaxId:584] [52884] (2 PDB entries) 
Domain d1pmt_2: 1pmt 1-80 [33034]
Other proteins in same PDB: d1pmt_1
Details for d1pmt_2
PDB Entry: 1pmt (more details), 2.5 Å
PDB Description: glutathione transferase from proteus mirabilis
SCOP Domain Sequences for d1pmt_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmt_2 c.47.1.5 (1-80) Glutathione S-transferase {Proteus mirabilis}
mklyytpgscslsphivlretgldfsieridlrtkktesgkdflainpkgqvpvlqldng
diltegvaivqyladlkpdr
SCOP Domain Coordinates for d1pmt_2:
Click to download the PDB-style file with coordinates for d1pmt_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pmt_2:
- d1pmt_2 appears in SCOP 1.57
- d1pmt_2 appears in the current release, SCOPe 2.08, called d1pmta2
View in 3D
