Lineage for d5gpab1 (5gpa B:8-78)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1982024Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1982025Protein automated matches [190674] (22 species)
    not a true protein
  7. 2287027Species Bacillus halodurans [TaxId:272558] [330328] (2 PDB entries)
  8. 2287032Domain d5gpab1: 5gpa B:8-78 [330333]
    Other proteins in same PDB: d5gpaa2, d5gpab2
    automated match to d1vi0a1
    complexed with gol, mg

Details for d5gpab1

PDB Entry: 5gpa (more details), 2.05 Å

PDB Description: structural analysis of fatty acid degradation regulator fadr from bacillus halodurans
PDB Compounds: (B:) Transcriptional regulator (TetR/AcrR family)

SCOPe Domain Sequences for d5gpab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gpab1 a.4.1.0 (B:8-78) automated matches {Bacillus halodurans [TaxId: 272558]}
kydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqekmgrfv
dkirsqmneat

SCOPe Domain Coordinates for d5gpab1:

Click to download the PDB-style file with coordinates for d5gpab1.
(The format of our PDB-style files is described here.)

Timeline for d5gpab1:

  • d5gpab1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-01

View in 3D
Domains from same chain:
(mouse over for more information)
d5gpab2