SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gpaa2 (5gpa A:79-195)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008470Family a.121.1.0: automated matches [227226] (1 protein)
    not a true family
  6. 2008471Protein automated matches [226967] (5 species)
    not a true protein
  7. 2287029Species Bacillus halodurans [TaxId:272558] [330330] (2 PDB entries)
  8. 2287030Domain d5gpaa2: 5gpa A:79-195 [330331]
    Other proteins in same PDB: d5gpaa1, d5gpab1
    automated match to d1vi0a2
    complexed with gol, mg

Details for d5gpaa2

PDB Entry: 5gpa (more details), 2.05 Å

PDB Description: structural analysis of fatty acid degradation regulator fadr from bacillus halodurans
PDB Compounds: (A:) Transcriptional regulator (TetR/AcrR family)

SCOPe Domain Sequences for d5gpaa2:

Sequence, based on SEQRES records: (download)

>d5gpaa2 a.121.1.0 (A:79-195) automated matches {Bacillus halodurans [TaxId: 272558]}
dveeklkilvnmhfkqlaadhklaivtqlelrqsntelalkinevlkgylnlldellmeg
kekgyffqeldtrlarqmifgtldevvtnwvmkdckydltalvkpvhqlllgglrhr

Sequence, based on observed residues (ATOM records): (download)

>d5gpaa2 a.121.1.0 (A:79-195) automated matches {Bacillus halodurans [TaxId: 272558]}
dveeklkilvnmhfkqlaadhklaivtqleltelalkinevlkgylnlldellmegkekg
yffqeldtrlarqmifgtldevvtnwvmkdckydltalvkpvhqlllgglrhr

SCOPe Domain Coordinates for d5gpaa2:

Click to download the PDB-style file with coordinates for d5gpaa2.
(The format of our PDB-style files is described here.)

Timeline for d5gpaa2:

  • d5gpaa2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-01

View in 3D
Domains from same chain:
(mouse over for more information)
d5gpaa1