SCOP 1.73: Domain d1b8xa2: 1b8x A:1-80

Lineage for d1b8xa2 (1b8x A:1-80)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class beta GST [81368] (3 species)

7. Species Escherichia coli [TaxId:562] [52883] (3 PDB entries)

8. Domain d1b8xa2: 1b8x A:1-80 [33033]
   Other proteins in same PDB: d1b8xa1

Details for d1b8xa2

PDB Entry: 1b8x, 2.7 Å

PDB Description: glutathione s-transferase fused with the nuclear matrix targeting signal of the transcription factor aml-1

PDB Compounds: (A:) protein (aml-1b)

SCOP Domain Sequences for d1b8xa2:

Sequence; same for both SEQRES and ATOM records:

>d1b8xa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]}
spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
dvkltqsmaiiryiadkhnm

Timeline for d1b8xa2:

• d1b8xa2 first appeared (with stable ids) in SCOP 1.55
  
• d1b8xa2 appears in SCOP 1.71
  
• d1b8xa2 appears in SCOP 1.75
  
• d1b8xa2 appears in the current release, SCOPe 2.08