SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5gpaa1 (5gpa A:3-78)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981148Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1982024Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1982025Protein automated matches [190674] (22 species)
    not a true protein
  7. 2287027Species Bacillus halodurans [TaxId:272558] [330328] (2 PDB entries)
  8. 2287028Domain d5gpaa1: 5gpa A:3-78 [330329]
    Other proteins in same PDB: d5gpaa2, d5gpab2
    automated match to d1vi0a1
    complexed with gol, mg

Details for d5gpaa1

PDB Entry: 5gpa (more details), 2.05 Å

PDB Description: structural analysis of fatty acid degradation regulator fadr from bacillus halodurans
PDB Compounds: (A:) Transcriptional regulator (TetR/AcrR family)

SCOPe Domain Sequences for d5gpaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gpaa1 a.4.1.0 (A:3-78) automated matches {Bacillus halodurans [TaxId: 272558]}
kkkgpkydqiidaavqviaehgyhqaqvskiakaagvadgtiylyfnnkedvlislfqek
mgrfvdkirsqmneat

SCOPe Domain Coordinates for d5gpaa1:

Click to download the PDB-style file with coordinates for d5gpaa1.
(The format of our PDB-style files is described here.)

Timeline for d5gpaa1:

  • d5gpaa1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-01

View in 3D
Domains from same chain:
(mouse over for more information)
d5gpaa2