Class b: All beta proteins [48724] (180 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) |
Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
Protein automated matches [190191] (2 species) not a true protein |
Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries) |
Domain d5b5ga_: 5b5g A: [330325] automated match to d4yvbb_ complexed with 6fx, so3 |
PDB Entry: 5b5g (more details), 1.5 Å
SCOPe Domain Sequences for d5b5ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b5ga_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]} gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
Timeline for d5b5ga_: