Lineage for d5fwda_ (5fwd A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146607Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2146608Protein automated matches [190689] (64 species)
    not a true protein
  7. 2146858Species Mouse (Mus musculus) [TaxId:10090] [187843] (16 PDB entries)
  8. 2146878Domain d5fwda_: 5fwd A: [330324]
    automated match to d2fyta1
    complexed with ca, cl, edo, gjv, pg4

Details for d5fwda_

PDB Entry: 5fwd (more details), 2 Å

PDB Description: crystal structure of mus musculus protein arginine methyltransferase 2 with cp2
PDB Compounds: (A:) Protein arginine N-methyltransferase 2

SCOPe Domain Sequences for d5fwda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fwda_ c.66.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dtwqdeeyfdsygtlklhlemladqprttkyhsvilqnkeslkdkvildvgcgtgiislf
cahharpkavyaveasdmaqhtsqlvlqngfadtitvfqqkvedvvlpekvdvlvsewmg
tcllfefmiesilyardtwlkgdgiiwpttaalhlvpcsaekdyhskvlfwdnayefnls
alkslaikeffsrpksnhilkpedclsepctilqldmrtvqvpdletmrgelrfdiqkag
tlhgftawfsvyfqsleegqpqqvlstgplhptthwkqtlfmmddpvpvhtgdvvtgsvv
lqrnpvwrrhmsvslswvvtsaldptsqrvgekvfpiww

SCOPe Domain Coordinates for d5fwda_:

Click to download the PDB-style file with coordinates for d5fwda_.
(The format of our PDB-style files is described here.)

Timeline for d5fwda_: