SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fwda_ (5fwd A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (63 species)
    not a true protein
  7. 2130813Species Mouse (Mus musculus) [TaxId:10090] [187843] (14 PDB entries)
  8. 2287023Domain d5fwda_: 5fwd A: [330324]
    automated match to d2fyta1
    complexed with ca, cl, edo, gjv, pg4

Details for d5fwda_

PDB Entry: 5fwd (more details), 2 Å

PDB Description: crystal structure of mus musculus protein arginine methyltransferase 2 with cp2
PDB Compounds: (A:) Protein arginine N-methyltransferase 2

SCOPe Domain Sequences for d5fwda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fwda_ c.66.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dtwqdeeyfdsygtlklhlemladqprttkyhsvilqnkeslkdkvildvgcgtgiislf
cahharpkavyaveasdmaqhtsqlvlqngfadtitvfqqkvedvvlpekvdvlvsewmg
tcllfefmiesilyardtwlkgdgiiwpttaalhlvpcsaekdyhskvlfwdnayefnls
alkslaikeffsrpksnhilkpedclsepctilqldmrtvqvpdletmrgelrfdiqkag
tlhgftawfsvyfqsleegqpqqvlstgplhptthwkqtlfmmddpvpvhtgdvvtgsvv
lqrnpvwrrhmsvslswvvtsaldptsqrvgekvfpiww

SCOPe Domain Coordinates for d5fwda_:

Click to download the PDB-style file with coordinates for d5fwda_.
(The format of our PDB-style files is described here.)

Timeline for d5fwda_:

  • d5fwda_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-01