SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b5fa_ (5b5f A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2063610Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2063611Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2063612Family b.61.1.1: Avidin/streptavidin [50877] (3 protein domains)
  6. 2063930Protein automated matches [190191] (2 species)
    not a true protein
  7. 2064009Species Streptomyces avidinii [TaxId:1895] [189343] (45 PDB entries)
  8. 2287022Domain d5b5fa_: 5b5f A: [330323]
    automated match to d4yvbb_
    complexed with 6f3

Details for d5b5fa_

PDB Entry: 5b5f (more details), 1.2 Å

PDB Description: crystal structure of alis3-streptavidin complex
PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d5b5fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b5fa_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp

SCOPe Domain Coordinates for d5b5fa_:

Click to download the PDB-style file with coordinates for d5b5fa_.
(The format of our PDB-style files is described here.)

Timeline for d5b5fa_:

  • d5b5fa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-01