SCOPe 2.07: Domain d5b66d_: 5b66 D:

Lineage for d5b66d_ (5b66 D:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (14 species)
   not a true protein

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (26 PDB entries)

8. Domain d5b66d_: 5b66 D: [330317]
   Other proteins in same PDB: d5b66b_, d5b66c_, d5b66e_, d5b66f_, d5b66h_, d5b66i_, d5b66j_, d5b66k_, d5b66l_, d5b66m_, d5b66o_, d5b66t_, d5b66u_, d5b66v_, d5b66x_, d5b66z_
   automated match to d3wu2d_
   complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b66d_

PDB Entry: 5b66, 1.85 Å

PDB Description: crystal structure analysis of photosystem ii complex

PDB Compounds: (D:) Photosystem II D2 protein

SCOPe Domain Sequences for d5b66d_:

Sequence; same for both SEQRES and ATOM records:

>d5b66d_ f.26.1.1 (D:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
ergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassyleg
cnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqf
eiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhn
wtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtan
rfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpe
fetfytknlllnegirawmapqdqphenfvfpeevlprgnal

Timeline for d5b66d_:

• d5b66d_ first appeared in SCOPe 2.06
  
• d5b66d_ appears in the current release, SCOPe 2.08