Lineage for d5b5ed_ (5b5e D:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2227758Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2227759Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2227760Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 protein domains)
    L and M are probably related to each other
  6. 2227944Protein automated matches [190224] (9 species)
    not a true protein
  7. 2228038Species Thermosynechococcus vulcanus [TaxId:32053] [189911] (10 PDB entries)
  8. 2287011Domain d5b5ed_: 5b5e D: [330312]
    Other proteins in same PDB: d5b5eb_, d5b5ec_, d5b5ee_, d5b5et_
    automated match to d3wu2d_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b5ed_

PDB Entry: 5b5e (more details), 1.87 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (D:) Photosystem II D2 protein

SCOPe Domain Sequences for d5b5ed_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b5ed_ f.26.1.1 (D:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
ergwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassyleg
cnfltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqf
eiarlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhn
wtlnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtan
rfwsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpe
fetfytknlllnegirawmapqdqphenfvfpeevlprgnal

SCOPe Domain Coordinates for d5b5ed_:

Click to download the PDB-style file with coordinates for d5b5ed_.
(The format of our PDB-style files is described here.)

Timeline for d5b5ed_:

  • d5b5ed_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-24