![]() | Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) ![]() |
![]() | Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins) Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284 |
![]() | Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species) |
![]() | Species Thermosynechococcus vulcanus [TaxId:32053] [189913] (10 PDB entries) |
![]() | Domain d5b5ee_: 5b5e e: [330310] Other proteins in same PDB: d5b5eb_, d5b5ec_, d5b5ed_, d5b5et_ automated match to d2axte1 complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 5b5e (more details), 1.87 Å
SCOPe Domain Sequences for d5b5ee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b5ee_ f.23.38.1 (e:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus vulcanus [TaxId: 32053]} gerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsipl vtdrfeakqqvetfleqlk
Timeline for d5b5ee_:
![]() Domains from other chains: (mouse over for more information) d5b5eb_, d5b5ec_, d5b5ed_, d5b5et_ |