SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b66o_ (5b66 O:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2224301Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
    not a true fold, gathers together transmembrane barrels of different (n,S)
  4. 2224302Superfamily f.4.1: OMPA-like [56925] (5 families) (S)
    forms (8,10) barrel
  5. 2224344Family f.4.1.4: PsbO-like [161115] (2 protein domains)
    Pfam PF01716; MSP
  6. 2224345Protein Manganese-stabilising protein, PsbO [161116] (2 species)
  7. 2224348Species Thermosynechococcus vulcanus [TaxId:32053] [189919] (10 PDB entries)
  8. 2287007Domain d5b66o_: 5b66 O: [330308]
    Other proteins in same PDB: d5b66d_, d5b66e_, d5b66f_, d5b66l_, d5b66m_, d5b66t_, d5b66x_
    automated match to d4il6o_
    complexed with bcr, bct, ca, cl, cla, dgd, dms, fe2, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, sqd, unl

Details for d5b66o_

PDB Entry: 5b66 (more details), 1.85 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (O:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d5b66o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b66o_ f.4.1.4 (O:) Manganese-stabilising protein, PsbO {Thermosynechococcus vulcanus [TaxId: 32053]}
tltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqea
efvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvk
nlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeela
ranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasi
epa

SCOPe Domain Coordinates for d5b66o_:

Click to download the PDB-style file with coordinates for d5b66o_.
(The format of our PDB-style files is described here.)

Timeline for d5b66o_:

  • d5b66o_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-24