SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wqab_ (5wqa B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014835Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2014836Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2014926Family a.211.1.2: PDEase [48548] (7 protein domains)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 2014986Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 2014987Species Human (Homo sapiens) [TaxId:9606] [89152] (39 PDB entries)
    Uniprot Q08499 388-713
  8. 2287002Domain d5wqab_: 5wqa B: [330303]
    automated match to d3g58a_
    complexed with j20, mg, zn

Details for d5wqab_

PDB Entry: 5wqa (more details), 2.3 Å

PDB Description: crystal structure of pde4d catalytic domain complexed with selaginpulvilins k
PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d5wqab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wqab_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
plwetwadlvhpdaqdildtlednrewyqstipq

SCOPe Domain Coordinates for d5wqab_:

Click to download the PDB-style file with coordinates for d5wqab_.
(The format of our PDB-style files is described here.)

Timeline for d5wqab_:

  • d5wqab_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23