Lineage for d5wvub_ (5wvu B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183652Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2183653Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2184728Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2184729Protein automated matches [190805] (17 species)
    not a true protein
  7. 2184845Species Thermus thermophilus HB8 [TaxId:300852] [188073] (2 PDB entries)
  8. 2287001Domain d5wvub_: 5wvu B: [330302]
    automated match to d1wgza_
    complexed with gol, zn

Details for d5wvub_

PDB Entry: 5wvu (more details), 2.6 Å

PDB Description: crystal structure of carboxypeptidase from thermus thermophilus
PDB Compounds: (B:) Thermostable carboxypeptidase 1

SCOPe Domain Sequences for d5wvub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wvub_ d.92.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mtpeaayqnllefqretaylaslgalaawdqrtmipkkghehrarqmaalarllhqrmtd
prigewlekvegsplvqdplsdaavnvrewrqayeraraiperlavelaqaeseaesfwe
earprddwrgflpylkrvyaltkekaevlfalppapgdppygelydalldgyepgmrare
llplfaelkeglkglldrilgsgkrpdtsilhrpypveaqrrfalellsacgydleagrl
dptahpfeiaigpgdvrittryyedffnagifgtlhemghalyeqglpkehwgtprgdav
slgvhesqsrtwenlvgrslgfwerffprarevfaslgdvsledfhfavnavepslirve
adevtynlhilvrlelelalfrgelspedlpeawaekyrdhlgvapkdykdgvmqdvhwa
gglfgyfptytlgnlyaaqffqkaeaelgpleprfargefqpfldwtrarihaegsrfrp
rvlvervtgeapsarpflaylekkyaalyg

SCOPe Domain Coordinates for d5wvub_:

Click to download the PDB-style file with coordinates for d5wvub_.
(The format of our PDB-style files is described here.)

Timeline for d5wvub_:

  • d5wvub_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23