SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5unca_ (5unc A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088358Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 2088359Protein automated matches [190614] (13 species)
    not a true protein
  7. 2286906Species Streptomyces platensis [TaxId:58346] [330207] (1 PDB entry)
  8. 2287000Domain d5unca_: 5unc A: [330301]
    automated match to d4iqea_
    complexed with fmt, tla, xys

Details for d5unca_

PDB Entry: 5unc (more details), 1.71 Å

PDB Description: the crystal structure of phosphoenolpyruvate phosphomutase from streptomyces platensis subsp. rosaceus
PDB Compounds: (A:) Phosphoenolpyruvate phosphomutase

SCOPe Domain Sequences for d5unca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5unca_ c.1.12.0 (A:) automated matches {Streptomyces platensis [TaxId: 58346]}
hgaaqlralfdapgtvriagahnplgarlaeragfdgiwssgleisasqglpdadiltmt
ellgvagsmasavgvpvvadcdtgygnannvmhmvrryeaagiaavtiedkrfpkvnsfi
pgrqelasvpefcgrieaakdaqrdpdfmviariealiagwdldealrrgeayaaagada
vlihaksgspqpvldflqrwhlpqpvvvvpttyhtisaaelgaagakmvvyanhglragi
qavsqtfetilkdgrttaiedhiaplttvfdlqgmdefqenekrfvrgg

SCOPe Domain Coordinates for d5unca_:

Click to download the PDB-style file with coordinates for d5unca_.
(The format of our PDB-style files is described here.)

Timeline for d5unca_:

  • d5unca_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-23