Lineage for d5wvuc_ (5wvu C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530330Species Thermus thermophilus HB8 [TaxId:300852] [188073] (1 PDB entry)
  8. 2530333Domain d5wvuc_: 5wvu C: [330300]
    automated match to d1wgza_
    complexed with gol, zn

Details for d5wvuc_

PDB Entry: 5wvu (more details), 2.6 Å

PDB Description: crystal structure of carboxypeptidase from thermus thermophilus
PDB Compounds: (C:) Thermostable carboxypeptidase 1

SCOPe Domain Sequences for d5wvuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wvuc_ d.92.1.0 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mtpeaayqnllefqretaylaslgalaawdqrtmipkkghehrarqmaalarllhqrmtd
prigewlekvegsplvqdplsdaavnvrewrqayeraraiperlavelaqaeseaesfwe
earprddwrgflpylkrvyaltkekaevlfalppapgdppygelydalldgyepgmrare
llplfaelkeglkglldrilgsgkrpdtsilhrpypveaqrrfalellsacgydleagrl
dptahpfeiaigpgdvrittryyedffnagifgtlhemghalyeqglpkehwgtprgdav
slgvhesqsrtwenlvgrslgfwerffprarevfaslgdvsledfhfavnavepslirve
adevtynlhilvrlelelalfrgelspedlpeawaekyrdhlgvapkdykdgvmqdvhwa
gglfgyfptytlgnlyaaqffqkaeaelgpleprfargefqpfldwtrarihaegsrfrp
rvlvervtgeapsarpflaylekkyaalyg

SCOPe Domain Coordinates for d5wvuc_:

Click to download the PDB-style file with coordinates for d5wvuc_.
(The format of our PDB-style files is described here.)

Timeline for d5wvuc_: